Structure of PDB 2gc7 Chain D

Receptor sequence

>2gc7D (length=147) Species: 266 (Paracoccus denitrificans)

APQFFNIIDGSPLNFDDAMEEGRDTEAVKHFLETGENVYNEDPEILPEAE
ELYAGMCSGCHGHYAEGKIGPGLNDAYWTYPGNETDVGLFSTLYGGATGQ
MGPMWGSLTLDEMLRTMAWVRHLYTGDPKDASWLTDEQKAGFTPFQP

3D structure

• PDB: 2gc7 Structure of an electron transfer complex: methylamine dehydrogenase, amicyanin and cytochrome c551i.
• Chain: D
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	D	M56 C57 C60 H61 P71 L73 W78 T79 Y80 N83 L93 T98 M101	M56 C57 C60 H61 P71 L73 W78 T79 Y80 N83 L93 T98 M101

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015945 methanol metabolic process

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:2gc7, PDBe:2gc7, PDBj:2gc7
• PDBsum: 2gc7
• UniProt: P29899|CYCL_PARDE Cytochrome c-L (Gene Name=moxG)