Structure of PDB 2gag Chain D |
>2gagD (length=91) Species: 40324 (Stenotrophomonas maltophilia) [Search protein sequence] |
MMLIDCPNCGPRNENEFKYGGEAHVAYPADPHALSDKQWSRYLFYRQNKK GIFAERWVHAAGCRKWFNALRDTVTYEFKAIYPAGAPRPEI |
|
PDB | 2gag Heterotetrameric sarcosine oxidase: structure of a diflavin metalloenzyme at 1.85 a resolution. |
Chain | D |
Resolution | 1.85 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
D |
C6 C9 H59 C63 |
C6 C9 H59 C63 |
|
|
|
|