Structure of PDB 2g4o Chain D

Receptor sequence

>2g4oD (length=337) Species: 1773 (Mycobacterium tuberculosis)

MSKLAIIAGDGIGPEVTAEAVKVLDAVVPGVQKTSYDLGARRFHATGEVL
PDSVVAELRNHDAILLGAIGDPSVPSGVLERGLLLRLRFELDHHINLRPA
RLYPGVASPLSGNPGIDFVVVREGTEGPYTGNGGAIRVGTPNEVATEVSV
NTAFGVRRVVADAFERARRRRKHLTLVHKTNVLTFAGGLWLRTVDEVGEC
YPDVEVAYQHVDAATIHMITDPGRFDVIVTDNLFGDIITDLAAAVCGGIG
LAASGNIDATRANPSMFEPVHGSAPDIAGQGIADPTAAIMSVALLLSHLG
EHDAAARVDRAVEAHLATRGSERLATSDVGERIAAAL

3D structure

• PDB: 2g4o On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
• Chain: D
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y128 K178 D211 D235 D239
• Catalytic site (residue number reindexed from 1): Y129 K179 D212 D236 D240
• Enzyme Commision number: 1.1.1.85: 3-isopropylmalate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SO4	D	G104 N112	G105 N113

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003862 3-isopropylmalate dehydrogenase activity
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
• GO:0046872 metal ion binding
• GO:0051287 NAD binding

Biological Process

• GO:0009098 L-leucine biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2g4o, PDBe:2g4o, PDBj:2g4o
• PDBsum: 2g4o
• PubMed: 17327674
• UniProt: P9WKK9|LEU3_MYCTU 3-isopropylmalate dehydrogenase (Gene Name=leuB)