Structure of PDB 2g1t Chain D

Receptor sequence

>2g1tD (length=277) Species: 9606 (Homo sapiens)

GHMSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKE
DTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLD
YLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENH
LVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAF
GVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRAC
WQWNPSDRPSFAEIHQAFETMFQESSI

3D structure

• PDB: 2g1t A SRC-like inactive conformation in the abl tyrosine kinase domain.
• Chain: D
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D363 A365 R367 N368 D381 P402
• Catalytic site (residue number reindexed from 1): D138 A140 R142 N143 D156 P177
• Enzyme Commision number: 2.7.10.2: non-specific protein-tyrosine kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	D	H396 A397 G398 A399 K400 F401 P402 I403 K404 L411 L445 Y449	H171 A172 G173 A174 K175 F176 P177 I178 K179 L186 L220 Y224
BS02	MG	D	N368 D381	N143 D156
BS03	112	D	G250 G251 Q252 Y253 V256 A269 K271 F317 M318 N322 D363 R367 N368 L370	G25 G26 Q27 Y28 V31 A44 K46 F92 M93 N97 D138 R142 N143 L145

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation

External links

• PDB: RCSB:2g1t, PDBe:2g1t, PDBj:2g1t
• PDBsum: 2g1t
• PubMed: 16640460
• UniProt: P00519|ABL1_HUMAN Tyrosine-protein kinase ABL1 (Gene Name=ABL1)