Structure of PDB 2fbw Chain D |
>2fbwD (length=101) Species: 9031 (Gallus gallus) [Search protein sequence] |
SKAASLHWTSERAVSALLLGLLPAAYLYPGPAVDYSLAAALTLHGHWGLG QVITDYVHGDTPIKVANTGLYVLSAITFTGLCYFNYYDVGICKAVAMLWS I |
|
PDB | 2fbw 3-nitropropionic acid is a suicide inhibitor of mitochondrial respiration that, upon oxidation by complex II, forms a covalent adduct with a catalytic base arginine in the active site of the enzyme. |
Chain | D |
Resolution | 2.06 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
HEM |
D |
H46 G50 |
H44 G48 |
|
|
|
|