Structure of PDB 2efe Chain D

Receptor sequence
>2efeD (length=165) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
SINAKLVLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAVNDA
TVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQE
LQAQGNPNMVMALAGNKSDLLDARKVTAEDAQTYAQENGLFFMETSAKTA
TNVKEIFYEIARRLP
3D structure
PDB2efe GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
ChainD
Resolution2.08 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GNH D G20 G22 K23 S24 S25 F35 N123 K124 D126 L127 S153 A154 K155 G13 G15 K16 S17 S18 F28 N116 K117 D119 L120 S146 A147 K148
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0036094 small molecule binding
GO:0140313 molecular sequestering activity
Biological Process
GO:0006886 intracellular protein transport
GO:0007033 vacuole organization
GO:0015031 protein transport
GO:0045324 late endosome to vacuole transport
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005769 early endosome
GO:0005783 endoplasmic reticulum
GO:0005886 plasma membrane
GO:0031901 early endosome membrane
GO:0032585 multivesicular body membrane
GO:0043229 intracellular organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2efe, PDBe:2efe, PDBj:2efe
PDBsum2efe
PubMed20833725
UniProtQ9SN68|RAF2B_ARATH Ras-related protein RABF2b (Gene Name=RABF2B)

[Back to BioLiP]