Structure of PDB 2e82 Chain D

Receptor sequence

>2e82D (length=340) Species: 9606 (Homo sapiens) [Search protein sequence]

MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAG
LWQPYLSDPNNPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHE
AIPDPSWKDTVLGFRKLTPRELDMFPDYGYGWFHTSLILEGKNYLQWLTE
RLTERGVKFFQRKVESFEEVAREGADVIVNCTGVWAGALQRDPLLQPGRG
QIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGGIFQLGNWSEL
NNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLS

3D structure

PDB

2e82 Structural basis of d-DOPA oxidation by d-amino acid oxidase: Alternative pathway for dopamine biosynthesis.

Chain

Resolution

2.7 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	L3051 G3313 T3317
Catalytic site (residue number reindexed from 1)	L51 G313 T317
Enzyme Commision number	1.4.3.3: D-amino-acid oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	D	G3007 G3009 I3011 D3037 R3038 T3044 T3045 A3048 G3050 L3051 K3163 V3164 T3182 G3183 W3185 R3283 G3312 G3313 Y3314 G3315 L3316 T3317	G7 G9 I11 D37 R38 T44 T45 A48 G50 L51 K163 V164 T182 G183 W185 R283 G312 G313 Y314 G315 L316 T317
BS02	IM3	D	L3215 H3217 Y3224 Y3228 R3283	L215 H217 Y224 Y228 R283

Gene Ontology

	Molecular Function
GO:0003884	D-amino-acid oxidase activity
GO:0005515	protein binding
GO:0016491	oxidoreductase activity
GO:0042802	identical protein binding
GO:0071949	FAD binding

	Biological Process
GO:0006562	proline catabolic process
GO:0007586	digestion
GO:0019478	D-amino acid catabolic process
GO:0036088	D-serine catabolic process
GO:0042416	dopamine biosynthetic process
GO:0046416	D-amino acid metabolic process
GO:0055130	D-alanine catabolic process
GO:0070178	D-serine metabolic process
GO:0070945	neutrophil-mediated killing of gram-negative bacterium

	Cellular Component
GO:0005576	extracellular region
GO:0005737	cytoplasm
GO:0005741	mitochondrial outer membrane
GO:0005777	peroxisome
GO:0005782	peroxisomal matrix
GO:0005829	cytosol
GO:0042995	cell projection
GO:0045202	synapse
GO:0048786	presynaptic active zone

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2e82, PDBe:2e82, PDBj:2e82
PDBsum	2e82
PubMed	17303072
UniProt	P14920\|OXDA_HUMAN D-amino-acid oxidase (Gene Name=DAO)

[Back to BioLiP]