Structure of PDB 2e7l Chain D |
>2e7lD (length=112) Species: 10090 (Mus musculus) [Search protein sequence] |
EAAVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHELRLIYYSY GAGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGGGGTLY FGAGTRLSVLSS |
|
PDB | 2e7l How a single T cell receptor recognizes both self and foreign MHC. |
Chain | D |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
D |
N30 Y50 G96 G97 |
N30 Y50 G95 G96 |
|
|
|