Structure of PDB 2c5c Chain D

Receptor sequence
>2c5cD (length=69) Species: 12371 (Phage h30) [Search protein sequence]
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTV
TIKTNACHNGGGFSEVIFR
3D structure
PDB2c5c Extensive Cross-Linking of the Shiga-Like Toxin 1 B Subunit by a Bivalent Ligand
ChainD
Resolution2.94 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GLA D R33 W34 N35 R33 W34 N35
BS02 GAL D T54 N55 G62 T54 N55 G62
BS03 GLA D T31 N32 R33 F63 S64 T31 N32 R33 F63 S64
Gene Ontology
Biological Process
GO:0019836 hemolysis by symbiont of host erythrocytes
GO:0098676 modulation of host virulence by virus
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2c5c, PDBe:2c5c, PDBj:2c5c
PDBsum2c5c
PubMed
UniProtP69178|STXB_BPH30 Shiga-like toxin 1 subunit B (Gene Name=stxB)

[Back to BioLiP]