Structure of PDB 2b5l Chain D

Receptor sequence
>2b5lD (length=175) [Search protein sequence]
KLIETGLNTVEYFTSQQVTGTSSLGKNTIPPGVTGLLTNARPKIAIVPAD
DKTVPGKPIPNPLLGLDSTPSTQTVLDLSGKTLPSGSYKGVKLAKFGKEN
LMTRFIEEPREIDFKRGRDTGGFHRREYSIGWVGDEVKVTEWCNPSCSPI
TAAARRFECTCHQCPVTCSECERDT
3D structure
PDB2b5l Structure of DDB1 in complex with a paramyxovirus V protein: viral hijack of a propeller cluster in ubiquitin ligase.
ChainD
Resolution2.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN D C194 C208 C211 C147 C161 C164
BS02 ZN D C190 C215 C218 C143 C168 C171
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0046872 metal ion binding
GO:1990756 ubiquitin-like ligase-substrate adaptor activity
Biological Process
GO:0019049 virus-mediated perturbation of host defense response
GO:0039502 symbiont-mediated suppression of host type I interferon-mediated signaling pathway
GO:0039554 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MDA-5 activity
GO:0039563 symbiont-mediated suppression of host JAK-STAT cascade via inhibition of STAT1 activity
GO:0039564 symbiont-mediated suppression of host JAK-STAT cascade via inhibition of STAT2 activity
GO:0044068 symbiont-mediated perturbation of host cellular process
Cellular Component
GO:0030430 host cell cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2b5l, PDBe:2b5l, PDBj:2b5l
PDBsum2b5l
PubMed16413485
UniProtP11207|V_PIV5 Non-structural protein V (Gene Name=P/V)

[Back to BioLiP]