Structure of PDB 2b3j Chain D

Receptor sequence
>2b3jD (length=150) Species: 158878 (Staphylococcus aureus subsp. aureus Mu50) [Search protein sequence]
NDIYFMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTA
HAEHIAIERAAKVLGSWRLEGCTLYVTLEPCVMCAGTIVMSRIPRVVYGA
DDPKGGCSGSLMNLLQQSNFNHRAIVDKGVLKEACSTLLTTFFKNLRANK
3D structure
PDB2b3j Crystal structure of Staphylococcus aureus tRNA adenosine deaminase TadA in complex with RNA.
ChainD
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H53 C83 C86
Catalytic site (residue number reindexed from 1) H51 C81 C84
Enzyme Commision number 3.5.4.33: tRNA(adenine(34)) deaminase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D G22 I26 N42 R44 E45 H53 L80 D103 D104 K106 S138 L141 F144 F145 L148 R149 K152 G20 I24 N40 R42 E43 H51 L78 D101 D102 K104 S136 L139 F142 F143 L146 R147 K150
BS02 ZN D H53 C83 C86 H51 C81 C84
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0008251 tRNA-specific adenosine deaminase activity
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
GO:0052717 tRNA-specific adenosine-34 deaminase activity
Biological Process
GO:0002100 tRNA wobble adenosine to inosine editing
GO:0008033 tRNA processing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2b3j, PDBe:2b3j, PDBj:2b3j
PDBsum2b3j
PubMed16415880
UniProtQ99W51|TADA_STAAM tRNA-specific adenosine deaminase (Gene Name=tadA)

[Back to BioLiP]