Structure of PDB 2b11 Chain D

Receptor sequence

>2b11D (length=108) Species: 4932 (Saccharomyces cerevisiae)

TEFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEG
YSYTDANIKKNVLWDENNMSEYLTNPKKYIPGTKMAWGGLKKEKDRNDLI
TYLKKACE

3D structure

• PDB: 2b11 Effects of interface mutations on association modes and electron-transfer rates between proteins
• Chain: D
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	D	R813 C814 C817 H818 I835 Y848 T849 M864 Y867 L868 T878 K879 M880 W882	R18 C19 C22 H23 I40 Y53 T54 M69 Y72 L73 T83 K84 M85 W87

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:1901612 cardiolipin binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:2b11, PDBe:2b11, PDBj:2b11
• PDBsum: 2b11
• PubMed: 16227441
• UniProt: P00044|CYC1_YEAST Cytochrome c isoform 1 (Gene Name=CYC1)