Structure of PDB 2az5 Chain D |
>2az5D (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] |
DKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIY SQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRAKPWYE PIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
|
PDB | 2az5 Small-molecule inhibition of TNF-alpha. |
Chain | D |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
307 |
D |
Y59 Y119 L120 G121 |
Y50 Y103 L104 G105 |
PDBbind-CN: -logKd/Ki=5.27,Kd=5.36uM BindingDB: Kd=5360nM,IC50=1300nM |
|
|
|