Structure of PDB 2a8k Chain D |
>2a8kD (length=94) Species: 562 (Escherichia coli) [Search protein sequence] |
LKIDQKIRGQMPERGWTEDDIKNTVSNGATGTSFDKRSPKKTPPDYLGRN DPATVYGSPGKYVVVNDRTGEVTQISDKTDPGWVDDSRIQWGNK |
|
PDB | 2a8k Structural and mutational studies of the catalytic domain of colicin E5: A tRNA-specific ribonuclease |
Chain | D |
Resolution | 1.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
D |
E24 T90 |
E13 T79 |
|
|
|
|