Structure of PDB 2a06 Chain D

Receptor sequence

>2a06D (length=241) Species: 9913 (Bos taurus)

SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRH
LVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEA
ARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFN
PYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDH
RKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK

3D structure

• PDB: 2a06 Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
• Chain: D
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.8: quinol--cytochrome-c reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	D	S13 L18 S19 S20 H23 T24 R27 G53 V54 C55 Y56 T57 D59 E60 D199 R203 L206 K207 L210 M211	S13 L18 S19 S20 H23 T24 R27 G53 V54 C55 Y56 T57 D59 E60 D199 R203 L206 K207 L210 M211
BS02	HEC	D	V36 C37 C40 H41 N105 P110 P111 R120 Y126 F153 I158 G159 M160 P163	V36 C37 C40 H41 N105 P110 P111 R120 Y126 F153 I158 G159 M160 P163
BS03	AZI	D	H225 S228	H225 S228

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding

External links

• PDB: RCSB:2a06, PDBe:2a06, PDBj:2a06
• PDBsum: 2a06
• PubMed: 16024040
• UniProt: P00125|CY1_BOVIN Cytochrome c1, heme protein, mitochondrial (Gene Name=CYC1)