Structure of PDB 1zzh Chain D

Receptor sequence

>1zzhD (length=298) Species: 1061 (Rhodobacter capsulatus)

ALREEAKGLFEVIPMQAPQVTRDKIDLGAMLFFDPRMSKSGVFSCQSCHN
VGLGGVDGLETSIGHGWQKGPRNAPTALNAVFNVAQFWDGRAPDLAAQAM
NNTPENLVATVQSMPGYVEAFAKAFPGQKDPISFDNFALAVEAFEATLIT
PNSKFDQWLMGADGAMSADEKAGLKLFIDTGCAACHNGINIGGNGYYPFG
VVEKPGRFAVTATADDEYVFRAGPLRNIALTAPYFHSGKVWDLREAVSVM
ANSQLGATLDDTQVDQITAFLGTLTGEQPEVVHPILPVRSAQTPRPEH

3D structure

• PDB: 1zzh Structural and mutagenesis studies on the cytochrome c peroxidase from Rhodobacter capsulatus provide new insights into structure-function relationships of bacterial di-heme peroxidases
• Chain: D
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	D	N82 T259 P261	N73 T231 P233
BS02	HEC	D	C54 C57 H58 S71 I72 G73 H74 W76 Q77 R81 A83 P84 N92 Q95 W97 R249	C45 C48 H49 S62 I63 G64 H65 W67 Q68 R72 A74 P75 N83 Q86 W88 R221
BS03	HEC	D	W97 C200 C203 H204 Y215 F217 G218 V219 F248 R249 A250 Y262 F263 H264 M278 L283	W88 C182 C185 H186 Y197 F199 G200 V201 F220 R221 A222 Y234 F235 H236 M250 L255

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 23 07:25:46 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '1zzh', asym_id = 'D', title = 'Structural and mutagenesis studies on the cytoch...n relationships of bacterial di-heme peroxidases '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='1zzh', asym_id='D', title='Structural and mutagenesis studies on the cytoch...n relationships of bacterial di-heme peroxidases ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009055,0016491,0020037', uniprot = '', pdbid = '1zzh', asym_id = 'D'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009055,0016491,0020037', uniprot='', pdbid='1zzh', asym_id='D')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>