Structure of PDB 1zs4 Chain D |
>1zs4D (length=73) Species: 10710 (Lambdavirus lambda) [Search protein sequence] |
RNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKRDWIPKFSMLLA VLEWGVVDDDMARLARQVAAILT |
|
PDB | 1zs4 Crystal Structure of Bacteriophage lambdacII and Its DNA Complex. |
Chain | D |
Resolution | 1.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
D |
W47 K50 |
W41 K44 |
|
|
|
|