Structure of PDB 1zm7 Chain D

Receptor sequence
>1zm7D (length=197) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVN
GVDLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSAR
YCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAY
ERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD
3D structure
PDB1zm7 Structural basis for the changed substrate specificity of Drosophila melanogaster deoxyribonucleoside kinase mutant N64D.
ChainD
Resolution2.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E52 R105
Catalytic site (residue number reindexed from 1) E41 R94
Enzyme Commision number 2.7.1.145: deoxynucleoside kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG D T34 E52 E104 T23 E41 E93
BS02 TTP D I29 G30 G32 K33 T34 V54 W57 Y70 F80 Q81 E104 R105 A110 F114 R167 R169 E172 I18 G19 G21 K22 T23 V43 W46 Y59 F69 Q70 E93 R94 A99 F103 R156 R158 E161 MOAD: ic50>1000uM
Gene Ontology
Molecular Function
GO:0004136 deoxyadenosine kinase activity
GO:0004137 deoxycytidine kinase activity
GO:0004138 deoxyguanosine kinase activity
GO:0004797 thymidine kinase activity
GO:0004849 uridine kinase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0019136 deoxynucleoside kinase activity
GO:0043771 cytidine kinase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0006170 dAMP biosynthetic process
GO:0006222 UMP biosynthetic process
GO:0009157 deoxyribonucleoside monophosphate biosynthetic process
GO:0009224 CMP biosynthetic process
GO:0016310 phosphorylation
GO:0043174 nucleoside salvage
GO:0071897 DNA biosynthetic process
GO:1901293 nucleoside phosphate biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1zm7, PDBe:1zm7, PDBj:1zm7
PDBsum1zm7
PubMed16008571
UniProtQ9XZT6|DNK_DROME Deoxynucleoside kinase (Gene Name=dnk)

[Back to BioLiP]