Structure of PDB 1zeg Chain D

Receptor sequence
>1zegD (length=30) Species: 9606 (Homo sapiens) [Search protein sequence]
FVNQHLCGSHLVEALYLVCGERGFFYTDKT
3D structure
PDB1zeg Interactions of phenol and m-cresol in the insulin hexamer, and their effect on the association properties of B28 pro --> Asp insulin analogues.
ChainD
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide D C7 L11 L15 C19 R22 G23 F24 F25 Y26 D28 T30 C7 L11 L15 C19 R22 G23 F24 F25 Y26 D28 T30
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1zeg, PDBe:1zeg, PDBj:1zeg
PDBsum1zeg
PubMed9708987
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]