Structure of PDB 1zbb Chain D

Receptor sequence
>1zbbD (length=107) Species: 8355 (Xenopus laevis) [Search protein sequence]
KKGSKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVND
VFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSAK
3D structure
PDB1zbb X-ray structure of a tetranucleosome and its implications for the chromatin fibre.
ChainD
Resolution9.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D K13 D22 G23 K24 K25 R26 R27 K28 R30 K31 E32 S33 I36 K6 D7 G8 K9 K10 R11 R12 K13 R15 K16 E17 S18 I21
BS02 dna D K8 K9 G10 S11 K12 K24 R26 R27 T29 S52 S53 R83 S84 T85 K1 K2 G3 S4 K5 K9 R11 R12 T14 S37 S38 R68 S69 T70
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1zbb, PDBe:1zbb, PDBj:1zbb
PDBsum1zbb
PubMed16001076
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]