Structure of PDB 1ymm Chain D |
>1ymmD (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] |
QALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHS GRLRVTLDTSKKSSSLLITASRAADTASYFCATDTTSGTYKYIFGT |
|
PDB | 1ymm Unconventional topology of self peptide-major histocompatibility complex binding by a human autoimmune T cell receptor. |
Chain | D |
Resolution | 3.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
D |
G96 Y98 |
G88 Y90 |
|
|
|