Structure of PDB 1y1s Chain D

Receptor sequence

>1y1sD (length=250) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)

SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSW
RAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHIN
VGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHV
GVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLL
TMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL

3D structure

• PDB: 1y1s Crystal Structures of Salmonella Typhimurium Uridine Phosphorylase in Native and Three Complexes Forms - with Uridine, Uracil and Sulfate.
• Chain: D
• Resolution: 2.55 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R3030 R3048 R3091 R3168 I3220 V3221
• Catalytic site (residue number reindexed from 1): R27 R45 R88 R165 I217 V218
• Enzyme Commision number: 2.4.2.3: uridine phosphorylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	URA	D	T3095 G3096 F3162 Q3166 E3196 M3197	T92 G93 F159 Q163 E193 M194

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004850 uridine phosphorylase activity
• GO:0016757 glycosyltransferase activity
• GO:0016763 pentosyltransferase activity
• GO:0047847 deoxyuridine phosphorylase activity

Biological Process

• GO:0009116 nucleoside metabolic process
• GO:0009164 nucleoside catabolic process
• GO:0009166 nucleotide catabolic process
• GO:0044206 UMP salvage

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1y1s, PDBe:1y1s, PDBj:1y1s
• PDBsum: 1y1s
• UniProt: P0A1F6|UDP_SALTY Uridine phosphorylase (Gene Name=udp)