Structure of PDB 1xf6 Chain D

Receptor sequence

>1xf6D (length=177) Species: 79257 (Rhodomonas sp. CS24) [Search protein sequence]

MLDAFSRVVTNADSKAAYVGGADLQALKKFISEGNKRLDSVNSIVSNASC
IVSDAVSGMICENPSLISPSGNCYTNRRMAACLRDGEIILRYVSYALLSG
DASVLEDRCLNGLKETYSSLGVPANSNARAVSIMKACAVAFVNNTASQKK
LSTPQGDCSGLASEVGGYFDKVTAAIS

3D structure

PDB

1xf6 Developing a structure-function model for the cryptophyte phycoerythrin 545 using ultrahigh resolution crystallography and ultrafast laser spectroscopy

Chain

Resolution

1.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	DBV	D	P64 I67	P64 I67
BS02	PEB	D	C50 D54 S57 G58 C61 R129 I133 A136 C137 A140 F141	C50 D54 S57 G58 C61 R129 I133 A136 C137 A140 F141
BS03	PEB	D	K28 N35 K36 L38 D39 V142 T153 P154 Q155 G156 C158	K28 N35 K36 L38 D39 V142 T153 P154 Q155 G156 C158
BS04	PEB	D	M59 N72 C73 R77 A81 C82 R84 D85 I88 L120 V122 N127	M59 N72 C73 R77 A81 C82 R84 D85 I88 L120 V122 N127

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1xf6, PDBe:1xf6, PDBj:1xf6
PDBsum	1xf6
PubMed	15504407
UniProt	P27198\|PHEB_RHDS2 B-phycoerythrin beta chain (Gene Name=cpeB)

[Back to BioLiP]