Structure of PDB 1ws8 Chain D |
>1ws8D (length=103) Species: 3663 (Cucurbita pepo) [Search protein sequence] |
MATVHKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQV DQEQFKSCNSSSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEI KVD |
|
PDB | 1ws8 Structural reorganization of the copper binding site involving Thr15 of mavicyanin from Cucurbita pepo medullosa (zucchini) upon reduction. |
Chain | D |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
D |
H45 C86 H91 Q96 |
H45 C86 H91 Q96 |
|
|
|
|