Structure of PDB 1u9m Chain D

Receptor sequence
>1u9mD (length=82) Species: 9913 (Bos taurus) [Search protein sequence]
AVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLREQAGG
DATENWEDVGHSTDARELSKTFIIGELHPDDR
3D structure
PDB1u9m Structure of the F58W mutant of cytochrome b5: the mutation leads to multiple conformations and weakens stacking interactions.
ChainD
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H39 G62
Catalytic site (residue number reindexed from 1) H37 G60
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM D F35 H39 P40 G41 V45 L46 W58 V61 H63 S64 A67 S71 F33 H37 P38 G39 V43 L44 W56 V59 H61 S62 A65 S69
BS02 HEM D K28 K72 I75 K26 K70 I73
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1u9m, PDBe:1u9m, PDBj:1u9m
PDBsum1u9m
PubMed15681869
UniProtP00171|CYB5_BOVIN Cytochrome b5 (Gene Name=CYB5A)

[Back to BioLiP]