Structure of PDB 1u1i Chain D

Receptor sequence

>1u1iD (length=392) Species: 224325 (Archaeoglobus fulgidus DSM 4304)

MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFS
FEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTA
LNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVAST
EPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFT
PSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVG
WMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFP
SLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFA
KKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK

3D structure

• PDB: 1u1i Reaching for Mechanistic Consensus Across Life Kingdoms: Structure and Insights into Catalysis of the myo-Inositol-1-phosphate Synthase (mIPS) from Archaeoglobus fulgidus
• Chain: D
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D1425 K1474 K1506 K1567
• Catalytic site (residue number reindexed from 1): D225 K274 K306 K367
• Enzyme Commision number: 5.5.1.4: inositol-3-phosphate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PO4	D	T1428 G1429 E1430 T1431 K1478 K1567	T228 G229 E230 T231 K278 K367
BS02	NAD	D	G1207 Y1209 G1210 I1211 V1212 E1257 I1258 T1299 A1348 S1349 T1350 Y1385 F1399 D1425 G1426 T1428 Y1460 D1461 K1474 D1532	G7 Y9 G10 I11 V12 E57 I58 T99 A148 S149 T150 Y185 F199 D225 G226 T228 Y260 D261 K274 D332

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004512 inositol-3-phosphate synthase activity

Biological Process

• GO:0006021 inositol biosynthetic process
• GO:0006629 lipid metabolic process
• GO:0008654 phospholipid biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0016020 membrane

External links

• PDB: RCSB:1u1i, PDBe:1u1i, PDBj:1u1i
• PDBsum: 1u1i
• PubMed: 15628862
• UniProt: O28480