Structure of PDB 1trr Chain D

Receptor sequence
>1trrD (length=104) Species: 562 (Escherichia coli) [Search protein sequence]
AQQSPYSAAMAEQRHEEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREAL
GTRVRIVEELLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLE
EVLL
3D structure
PDB1trr Tandem binding in crystals of a trp repressor/operator half-site complex.
ChainD
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D S5 R54 A77 I79 T81 R84 S4 R53 A76 I78 T80 R83
BS02 dna D A2 Q3 R15 T44 Q68 R69 I79 T83 S86 N87 K90 A1 Q2 R14 T43 Q67 R68 I78 T82 S85 N86 K89
BS03 TRP D L41 M42 L43 T44 L40 M41 L42 T43
BS04 TRP D R54 R84 G85 S88 R53 R83 G84 S87
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1trr, PDBe:1trr, PDBj:1trr
PDBsum1trr
PubMed8232559
UniProtP0A881|TRPR_ECOLI Trp operon repressor (Gene Name=trpR)

[Back to BioLiP]