Structure of PDB 1scf Chain D |
>1scfD (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] |
NVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLL DKFSNISEGLSNYSIIDKLVNIVDDLVECVSPEPRLFTPEEFFRIFNRSI DAFK |
|
PDB | 1scf Structure of the active core of human stem cell factor and analysis of binding to its receptor kit. |
Chain | D |
Resolution | 2.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
D |
D54 D58 |
D44 D48 |
|
|
|
|