Structure of PDB 1rkr Chain D |
>1rkrD (length=129) Species: 85698 (Achromobacter xylosoxidans) [Search protein sequence] |
AECSVDIAGNDGMQFDKKEITVSKSCKQFTVNLKHPGKLAKNVMGHNWVL TKQADMQGAVNDGMAAGLDNNYVKKDDARVIAHTKVIGGGETDSVTFDVS KLAAGEDYAYFCSFPGHFALMKGVLKLVD |
|
PDB | 1rkr Structure of azurin I from the denitrifying bacterium Alcaligenes xylosoxidans NCIMB 11015 at 2.45 A resolution. |
Chain | D |
Resolution | 2.45 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
D |
H46 C112 H117 |
H46 C112 H117 |
|
|
|
|