Structure of PDB 1r4a Chain D

Receptor sequence
>1r4aD (length=165) Species: 10116 (Rattus norvegicus) [Search protein sequence]
REMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQV
WDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEE
LRKAILVVFANKQDMEQAMTPSEMANALGLPALKDRKWQIFKTSATKGTG
LDEAMEWLVETLKSR
3D structure
PDB1r4a Structural basis for recruitment of GRIP domain golgin-245 by small GTPase Arl1.
ChainD
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 MG D T31 T48 T16 T33
BS02 GNP D D26 G29 K30 T31 T32 V43 T45 T48 G70 N126 K127 D129 M130 S159 A160 T161 D11 G14 K15 T16 T17 V28 T30 T33 G55 N111 K112 D114 M115 S144 A145 T146
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005525 GTP binding
GO:0008047 enzyme activator activity
GO:0019904 protein domain specific binding
GO:0046872 metal ion binding
GO:1990583 phospholipase D activator activity
Biological Process
GO:0006886 intracellular protein transport
GO:0007030 Golgi organization
GO:0009404 toxin metabolic process
GO:0016192 vesicle-mediated transport
GO:0034067 protein localization to Golgi apparatus
GO:0042147 retrograde transport, endosome to Golgi
GO:0048193 Golgi vesicle transport
Cellular Component
GO:0000139 Golgi membrane
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005802 trans-Golgi network
GO:0005829 cytosol
GO:0016020 membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1r4a, PDBe:1r4a, PDBj:1r4a
PDBsum1r4a
PubMed14718928
UniProtP61212|ARL1_RAT ADP-ribosylation factor-like protein 1 (Gene Name=Arl1)

[Back to BioLiP]