Structure of PDB 1qxs Chain D

Receptor sequence

>1qxsD (length=359) Species: 5693 (Trypanosoma cruzi)

MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQM
RYDTVHGKFKYEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWG
KLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNH
HEYNPSEHHVVSNASCTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQ
KTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLTGMSFRV
PTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSAD
FINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHM
ASKDRSARL

3D structure

• PDB: 1qxs Crystal structure of Trypanosoma cruzi glyceraldehyde-3-phosphate dehydrogenase complexed with an analogue of 1,3-bisphospho-d-glyceric acid.
• Chain: D
• Resolution: 2.75 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C166 H194
• Catalytic site (residue number reindexed from 1): C166 H194
• Enzyme Commision number: 1.2.1.12: glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	D	G9 G11 R12 I13 D38 A90 S110 T111 G112 S134 C166 N335 Y339	G9 G11 R12 I13 D38 A90 S110 T111 G112 S134 C166 N335 Y339

Gene Ontology

Molecular Function

• GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
• GO:0016491 oxidoreductase activity
• GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
• GO:0050661 NADP binding
• GO:0051287 NAD binding

Biological Process

• GO:0006006 glucose metabolic process
• GO:0006096 glycolytic process

Cellular Component

• GO:0005829 cytosol
• GO:0020015 glycosome

External links

• PDB: RCSB:1qxs, PDBe:1qxs, PDBj:1qxs
• PDBsum: 1qxs
• PubMed: 14622286
• UniProt: P22513|G3PG_TRYCR Glyceraldehyde-3-phosphate dehydrogenase, glycosomal