Structure of PDB 1qp9 Chain D

Receptor sequence
>1qp9D (length=75) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
RKRNRIPLGCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEA
EKELLKDNELKKLRERVKSLEKTLS
3D structure
PDB1qp9 Structure of HAP1-PC7 bound to DNA: implications for DNA recognition and allosteric effects of DNA-binding on transcriptional activation.
ChainD
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R57 N58 R59 K71 R3 N4 R5 K17 PDBbind-CN: Kd=37.8nM
BS02 dna D K56 R57 R59 P61 K71 V72 K73 K2 R3 R5 P7 K17 V18 K19 PDBbind-CN: Kd=37.8nM
BS03 ZN D H80 H91 H26 H37
BS04 ZN D C64 C67 C74 C81 C10 C13 C20 C27
BS05 ZN D C64 C81 C84 C93 C10 C27 C30 C39
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1qp9, PDBe:1qp9, PDBj:1qp9
PDBsum1qp9
PubMed11024163
UniProtP0CS82|HAP1_YEASX Heme-responsive zinc finger transcription factor HAP1 (Gene Name=HAP1)

[Back to BioLiP]