Structure of PDB 1q90 Chain D

Receptor sequence
>1q90D (length=156) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
TKKPDLSDPVLKAKLAKGMGHNTYGEPAWPNDLLYMFPVVILGTFACVIG
LSVLDPAAMGEPANPFATPLEILPEWYFYPVFQILRVVPNKLLGVLLMAA
VPAGLITVPFIESINKFQNPYRRPIATILFLLGTLVAVWLGIGSTFPIDI
SLTLGL
3D structure
PDB1q90 An Atypical Haem in the Cytochrome B6F Complex
ChainD
Resolution3.1 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E78
Catalytic site (residue number reindexed from 1) E75
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC D F40 I44 F37 I41
BS02 CLA D Y80 F81 P83 V104 F133 G136 V139 Y77 F78 P80 V101 F130 G133 V136
BS03 TDS D I75 P77 F85 M101 I72 P74 F82 M98
Gene Ontology
Molecular Function
GO:0008121 ubiquinol-cytochrome-c reductase activity
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0009507 chloroplast
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane
GO:0042651 thylakoid membrane
GO:0045275 respiratory chain complex III

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1q90, PDBe:1q90, PDBj:1q90
PDBsum1q90
PubMed14647374
UniProtP23230|PETD_CHLRE Cytochrome b6-f complex subunit 4 (Gene Name=petD)

[Back to BioLiP]