Structure of PDB 1p4e Chain D

Receptor sequence

>1p4eD (length=409) Species: 4932 (Saccharomyces cerevisiae)

SQFDILCKTPPKVLVRQFVERFERPSGEKIASCAAELTYLCWMITHNGTA
IKRATFMSYNTIISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWE
FTIIPYNSDITDIVSSLQLQFESSGNSHSKKMLKALLSEGESIWEITEKI
LNSFEYTSRFTKTKTLYQFLFLATFINCGRFSDIKNVDPKSFKLVQNKYL
GVIIQCLVTETKTSVSRHIYFFSARGRIDPLVYLDEFLRNSEPVLKRVNR
TGNSNKQEYQLLKDNLVRSYNKALKKNAPYPIFAIKNGPKSHIGRHLMTS
FLSMKGLTELTNVVGNFSDKRASAVARTTYTHQITAIPDHYFALVSRYYA
YDPISKEMIALKDETNPIEEWQHIEQLKGSAEGSIRYPAWNGIISQEVLD
YLSSYINRR

3D structure

• PDB: 1p4e The role of the conserved Trp330 in Flp-mediated recombination. Functional and structural analysis
• Chain: D
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	D	H47 K53 A55 T56 Y60 K82 T83 N108 F192 S193 K223 R281 N284 K299 N300 K303 S304 H305	H46 K52 A54 T55 Y59 K81 T82 N107 F181 S182 K212 R268 N271 K286 N287 K290 S291 H292
BS02	dna	D	Q3 T62 R170 T174 Y178 K223 T224 N278 R281 S282 K285 K289 S331	Q2 T61 R159 T163 Y167 K212 T213 N265 R268 S269 K272 K276 S318
BS03	2PO	D	R191 K223 H305	R180 K212 H292

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003690 double-stranded DNA binding
• GO:0003697 single-stranded DNA binding
• GO:0008301 DNA binding, bending
• GO:0009009 site-specific recombinase activity

Biological Process

• GO:0006310 DNA recombination
• GO:0015074 DNA integration
• GO:0042150 plasmid recombination

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:1p4e, PDBe:1p4e, PDBj:1p4e
• PDBsum: 1p4e
• PubMed: 12716882
• UniProt: P03870|FLP_YEAST Site-specific recombinase Flp (Gene Name=FLP1)