Structure of PDB 1nkp Chain D

Receptor sequence
>1nkpD (length=83) Species: 9606 (Homo sapiens) [Search protein sequence]
MNVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATA
YILSVQAEEQKLISEEDLLRKRREQLKHKLEQL
3D structure
PDB1nkp X-ray structures of Myc-Max and Mad-Max recognizing DNA: Molecular bases of regulation by proto-oncogenic transcription factors
ChainD
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R503 H506 N507 E510 R511 R514 K518 P538 K539 R5 H8 N9 E12 R13 R16 K20 P40 K41 PDBbind-CN: Kd=90nM
BS02 dna D K502 E510 R513 K4 E12 R15 PDBbind-CN: Kd=90nM
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1nkp, PDBe:1nkp, PDBj:1nkp
PDBsum1nkp
PubMed12553908
UniProtP01106|MYC_HUMAN Myc proto-oncogene protein (Gene Name=MYC)

[Back to BioLiP]