Structure of PDB 1nen Chain D

Receptor sequence

>1nenD (length=113) Species: 562 (Escherichia coli)

SNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFF
ASAFTKVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALV
VYVIYGFVVVWGV

3D structure

• PDB: 1nen Architecture of succinate dehydrogenase and reactive oxygen species generation
• Chain: D
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	D	A23 L26 T27 I68 H71 G75	A21 L24 T25 I66 H69 G73
BS02	CDN	D	I30 F37 G41 W48	I28 F35 G39 W46

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006099 tricarboxylic acid cycle
• GO:0009060 aerobic respiration
• GO:0017004 cytochrome complex assembly
• GO:0019646 aerobic electron transport chain

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:1nen, PDBe:1nen, PDBj:1nen
• PDBsum: 1nen
• PubMed: 12560550
• UniProt: P0AC44|DHSD_ECOLI Succinate dehydrogenase hydrophobic membrane anchor subunit (Gene Name=sdhD)