Structure of PDB 1mpj Chain D

Receptor sequence
>1mpjD (length=30) Species: 9823 (Sus scrofa) [Search protein sequence]
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
3D structure
PDB1mpj X-ray crystallographic studies on hexameric insulins in the presence of helix-stabilizing agents, thiocyanate, methylparaben, and phenol.
ChainD
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide D G8 V12 E13 Y16 R22 G23 F24 F25 Y26 G8 V12 E13 Y16 R22 G23 F24 F25 Y26
BS02 peptide D F1 N3 Q4 H5 L6 C7 L15 V18 C19 R22 G23 F24 F25 P28 A30 F1 N3 Q4 H5 L6 C7 L15 V18 C19 R22 G23 F24 F25 P28 A30
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1mpj, PDBe:1mpj, PDBj:1mpj
PDBsum1mpj
PubMed7492558
UniProtP01315|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]