Structure of PDB 1mjo Chain D

Receptor sequence
>1mjoD (length=104) Species: 562 (Escherichia coli) [Search protein sequence]
AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRKVNNLRH
ATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPE
TWEY
3D structure
PDB1mjo Direct and indirect readout in mutant Met repressor-operator complexes.
ChainD
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D T25 S27 T25 S27
BS02 dna D H14 G15 K17 S18 K23 R40 T52 N53 S54 H14 G15 K17 S18 K23 R40 T52 N53 S54
BS03 SAM D E39 R43 L56 E59 H63 L70 P71 E39 R43 L56 E59 H63 L70 P71
BS04 SAM D F61 H63 A64 F65 F61 H63 A64 F65
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006555 methionine metabolic process
GO:0009086 methionine biosynthetic process
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mjo, PDBe:1mjo, PDBj:1mjo
PDBsum1mjo
PubMed10986458
UniProtP0A8U6|METJ_ECOLI Met repressor (Gene Name=metJ)

[Back to BioLiP]