Structure of PDB 1m5a Chain D

Receptor sequence

>1m5aD (length=30) Species: 9823 (Sus scrofa)

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

3D structure

• PDB: 1m5a The high-resolution structure of hexameric T6 cobalt insulin: A possible pathway for the T to R transition.
• Chain: D
• Resolution: 1.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	D	F1 N3 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 Y26 A30	F1 N3 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 Y26 A30

Gene Ontology

Molecular Function

• GO:0005179 hormone activity

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1m5a, PDBe:1m5a, PDBj:1m5a
• PDBsum: 1m5a
• UniProt: P01315|INS_PIG Insulin (Gene Name=INS)