Structure of PDB 1m1p Chain D

Receptor sequence

>1m1pD (length=86) Species: 70863 (Shewanella oneidensis) [Search protein sequence]

KLSDFHAESGGCESCHKDGTPSADGAFEFAQCQSCHGKLSEMDAVHKPHD
GNLVCADCHAVHDMNVGQKPTCESCHDDGRTSASVL

3D structure

PDB

1m1p Crystal structures at atomic resolution reveal the novel concept of 'electron-harvesting' as a role for the small tetraheme cytochrome c

Chain

Resolution

1.55 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	D	H9 C15 C18 H19 P24 A63 V64 H65	H6 C12 C15 H16 P21 A60 V61 H62
BS02	HEC	D	P51 H52 L56 C75 C78 H79 R83	P48 H49 L53 C72 C75 H76 R80
BS03	HEC	D	L5 F8 H9 Q34 C35 C38 H39 H62 V69 G70	L2 F5 H6 Q31 C32 C35 H36 H59 V66 G67
BS04	HEC	D	H39 L42 H49 H52 C58 C61 H62 K72 P73 S85	H36 L39 H46 H49 C55 C58 H59 K69 P70 S82

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

	Cellular Component
GO:0042597	periplasmic space

External links