Structure of PDB 1m1a Chain D

Receptor sequence
>1m1aD (length=93) Species: 8355 (Xenopus laevis) [Search protein sequence]
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
3D structure
PDB1m1a Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
ChainD
Resolution2.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D T1229 R1230 S1252 S1253 R1283 S1284 T1285 T1 R2 S24 S25 R55 S56 T57 PDBbind-CN: Kd=0.6uM
BS02 dna D R1230 K1231 E1232 S1233 I1236 Y1237 R2 K3 E4 S5 I8 Y9 PDBbind-CN: Kd=0.6uM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1m1a, PDBe:1m1a, PDBj:1m1a
PDBsum1m1a
PubMed12559907
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]