Structure of PDB 1llm Chain D

Receptor sequence
>1llmD (length=85) Species: 10090,559292 [Search protein sequence]
MKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH
RDIQHILPILEDKVEELLSKNYHLENEVARLKKLV
3D structure
PDB1llm Structure of a designed dimeric zinc finger protein bound to DNA.
ChainD
Resolution1.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R211 S214 R215 H218 H222 T225 R239 F241 R243 E246 R249 H250 Q254 R11 S14 R15 H18 H22 T25 R39 F41 R43 E46 R49 H50 Q54
BS02 dna D S216 D217 T220 S244 K248 R249 S16 D17 T20 S44 K48 R49
BS03 ZN D C206 C209 H222 H226 C6 C9 H22 H26
BS04 ZN D C234 C237 H250 H255 C34 C37 H50 H55
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1llm, PDBe:1llm, PDBj:1llm
PDBsum1llm
PubMed14621985
UniProtP03069|GCN4_YEAST General control transcription factor GCN4 (Gene Name=GCN4);
P08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]