Structure of PDB 1kzu Chain D

Receptor sequence
>1kzuD (length=49) Species: 1074 (Rhodoblastus acidophilus) [Search protein sequence]
MNQGKIWTVVNPAIGIPALLGSVTVIAILVHLAILSHTTWFPAYWQGGV
3D structure
PDB1kzu Apoprotein structure in the LH2 complex from Rhodopseudomonas acidophila strain 10050: modular assembly and protein pigment interactions.
ChainD
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL D Y44 W45 Y44 W45
BS02 BCL D L20 T24 H31 W40 F41 W45 L20 T24 H31 W40 F41 W45
BS03 BCL D M1 N2 M1 N2
BS04 BCL D V30 H31 V30 H31
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1kzu, PDBe:1kzu, PDBj:1kzu
PDBsum1kzu
PubMed9159480
UniProtP26789|LHA4_RHOAC Light-harvesting protein B-800/850 alpha chain

[Back to BioLiP]