Structure of PDB 1kqn Chain D

Receptor sequence
>1kqnD (length=231) Species: 9606 (Homo sapiens) [Search protein sequence]
KTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAY
KKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEK
LEAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQ
KFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLV
QEYIEKHNLYSSESEDRNAGVILAPLQRNTA
3D structure
PDB1kqn Structure of Human Nicotinamide/Nicotonic Acid Mononucleotide Adenylyltransferase. Basis for the dual substrate specificity and activation of the oncolytic agent tiazofurin.
ChainD
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.7.1: nicotinamide-nucleotide adenylyltransferase.
2.7.7.18: nicotinate-nucleotide adenylyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAD D C14 G15 S16 F17 M23 H24 L27 Y55 K57 W92 E94 T95 C155 G156 L159 L168 W169 P269 C9 G10 S11 F12 M18 H19 L22 Y50 K52 W87 E89 T90 C111 G112 L115 L124 W125 P225
Gene Ontology
Molecular Function
GO:0000309 nicotinamide-nucleotide adenylyltransferase activity
GO:0003824 catalytic activity
GO:0004515 nicotinate-nucleotide adenylyltransferase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016779 nucleotidyltransferase activity
GO:0042802 identical protein binding
GO:0070566 adenylyltransferase activity
GO:0140768 protein ADP-ribosyltransferase-substrate adaptor activity
Biological Process
GO:0009058 biosynthetic process
GO:0009165 nucleotide biosynthetic process
GO:0009435 NAD biosynthetic process
GO:0009611 response to wounding
GO:0019363 pyridine nucleotide biosynthetic process
GO:0043410 positive regulation of MAPK cascade
GO:0043524 negative regulation of neuron apoptotic process
GO:0045892 negative regulation of DNA-templated transcription
GO:1902511 negative regulation of apoptotic DNA fragmentation
GO:1990966 ATP generation from poly-ADP-D-ribose
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0016604 nuclear body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1kqn, PDBe:1kqn, PDBj:1kqn
PDBsum1kqn
PubMed11788603
UniProtQ9HAN9|NMNA1_HUMAN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 (Gene Name=NMNAT1)

[Back to BioLiP]