Structure of PDB 1kpg Chain D

Receptor sequence

>1kpgD (length=283) Species: 1773 (Mycobacterium tuberculosis)

LKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKID
LALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQ
QLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLA
HRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGR
LPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQ
SEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK

3D structure

• PDB: 1kpg Crystal structures of mycolic acid cyclopropane synthases from Mycobacterium tuberculosis
• Chain: D
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.79: cyclopropane-fatty-acyl-phospholipid synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CO3	D	S34 C35 G137 H167 I169 Y232	S30 C31 G133 H163 I165 Y228
BS02	SAH	D	V12 Y16 T32 Y33 S34 G72 G74 T94 L95 Q99 G122 W123 E124 I136 G137 A138 H141 F142	V8 Y12 T28 Y29 S30 G68 G70 T90 L91 Q95 G118 W119 E120 I132 G133 A134 H137 F138
BS03	16A	D	Y33 G137 I195 F200 G203 R204 L205 Y232 C269	Y29 G133 I191 F196 G199 R200 L201 Y228 C265

Gene Ontology

Molecular Function

• GO:0008168 methyltransferase activity
• GO:0008825 cyclopropane-fatty-acyl-phospholipid synthase activity

Biological Process

• GO:0006629 lipid metabolic process
• GO:0008610 lipid biosynthetic process
• GO:0032259 methylation
• GO:0046500 S-adenosylmethionine metabolic process
• GO:0071768 mycolic acid biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane

External links

• PDB: RCSB:1kpg, PDBe:1kpg, PDBj:1kpg
• PDBsum: 1kpg
• PubMed: 11756461
• UniProt: P9WPB7|CMAS1_MYCTU Cyclopropane mycolic acid synthase 1 (Gene Name=cmaA1)