Structure of PDB 1kib Chain D

Receptor sequence

>1kibD (length=89) Species: 129910 (Limnospira maxima)

GDVAAGASVFSANCAACHMGGRNVIVANKTLSKSDLAKYLKGFDDDAVAA
VAYQVTNGKNAMPGFNGRLSPKQIEDVAAYVVDQAEKGW

3D structure

• PDB: 1kib Structure of cytochrome c6 from Arthrospira maxima: an assembly of 24 subunits in a nearly symmetric shell.
• Chain: D
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	D	C14 C17 H18 N23 I25 K29 T30 L31 N60 M62 F65	C14 C17 H18 N23 I25 K29 T30 L31 N60 M62 F65

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009579 thylakoid
• GO:0031977 thylakoid lumen
• GO:0031979 plasma membrane-derived thylakoid lumen

External links

• PDB: RCSB:1kib, PDBe:1kib, PDBj:1kib
• PDBsum: 1kib
• PubMed: 12077429
• UniProt: P00118|CYC6_LIMMA Cytochrome c6 (Gene Name=petJ)