Structure of PDB 1k73 Chain D

Receptor sequence

>1k73D (length=337) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTH
VVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEV
WTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDA
VPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYA
DVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRST
VPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGS
VPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG

3D structure

PDB

1k73 Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit

Chain

Resolution

3.01 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	P1 Q2 P3 S4 R5 P6 R7 K8 G9 S10 L11 G12 F13 G14 P15 R16 K17 R18 R25 N27 S28 K45 M48 T49 H50 N59 P70 R85 Y87 Y92 Q94 P96 L97 E99 W101 R111 T112 L113 D114 P116 E117 R141 P155 K156 K157 K158 V161 E163 T206 K207 G208 K209 G210 T211 Q212 G213 K216 R217 V220 Q221 K222 R223 K224 G225 K226 H227 R229 Q230 G231 W232 R233 R234 R235 G237 N238 L239 G240 P241 W242 N243 P244 S245 R246 V247 R248 S249 T250 V251 P252 Q253 Q254 Q256 Y259 Q261 R262 T263 E264 L265 N266 K267 D281 G282 V285 N286 G288 E289 G299 S300 V301 P302 G303 K306 R307 R312 R316 N318 S334 N335 Q336 G337	P1 Q2 P3 S4 R5 P6 R7 K8 G9 S10 L11 G12 F13 G14 P15 R16 K17 R18 R25 N27 S28 K45 M48 T49 H50 N59 P70 R85 Y87 Y92 Q94 P96 L97 E99 W101 R111 T112 L113 D114 P116 E117 R141 P155 K156 K157 K158 V161 E163 T206 K207 G208 K209 G210 T211 Q212 G213 K216 R217 V220 Q221 K222 R223 K224 G225 K226 H227 R229 Q230 G231 W232 R233 R234 R235 G237 N238 L239 G240 P241 W242 N243 P244 S245 R246 V247 R248 S249 T250 V251 P252 Q253 Q254 Q256 Y259 Q261 R262 T263 E264 L265 N266 K267 D281 G282 V285 N286 G288 E289 G299 S300 V301 P302 G303 K306 R307 R312 R316 N318 S334 N335 Q336 G337

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1k73, PDBe:1k73, PDBj:1k73
PDBsum	1k73
PubMed	12860128
UniProt	P20279\|RL3_HALMA Large ribosomal subunit protein uL3 (Gene Name=rpl3)

[Back to BioLiP]