Structure of PDB 1jl3 Chain D

Receptor sequence
>1jl3D (length=124) Species: 1423 (Bacillus subtilis) [Search protein sequence]
KIIYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLNPNAVKAMK
EVGIDISNQTSDIIDSDILNNADLVVTLCGVKREHWGFDDPARAQGTEEE
KWAFFQRVRDEIGNRLKEFAETGK
3D structure
PDB1jl3 Bacillus subtilis arsenate reductase is structurally and functionally similar to low molecular weight protein tyrosine phosphatases.
ChainD
Resolution1.6 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C10 T11 G12 N13 S14 C15 R16 S17 S36 T63 D65 C82 D105
Catalytic site (residue number reindexed from 1) C7 T8 G9 N10 S11 C12 R13 S14 S33 T60 D62 C79 D90
Enzyme Commision number 1.20.4.4: arsenate reductase (thioredoxin).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SO4 D C10 G12 S14 C15 R16 S17 C7 G9 S11 C12 R13 S14
Gene Ontology
Molecular Function
GO:0004725 protein tyrosine phosphatase activity
GO:0016491 oxidoreductase activity
GO:0030612 arsenate reductase (thioredoxin) activity
Biological Process
GO:0046685 response to arsenic-containing substance
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1jl3, PDBe:1jl3, PDBj:1jl3
PDBsum1jl3
PubMed11698660
UniProtP45947|ARSC_BACSU Arsenate reductase (Gene Name=arsC)

[Back to BioLiP]