Structure of PDB 1jeb Chain D

Receptor sequence
>1jebD (length=146) Species: 10090 (Mus musculus) [Search protein sequence]
VHLTDAEKAAVSGLWGKVNADEVGGEALGRLLVVYPWTQRYFDSFGDLSS
ASAIMGNAKVKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDP
ENFRLLGNMIVIVLGHHLGKDFTPAAQAAFQKVVAGVAAALAHKYH
3D structure
PDB1jeb The role of beta chains in the control of the hemoglobin oxygen binding function: chimeric human/mouse proteins, structure, and function.
ChainD
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM D Y41 F42 H63 L88 H92 L96 V98 N102 F103 L106 L141 Y41 F42 H63 L88 H92 L96 V98 N102 F103 L106 L141
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015670 carbon dioxide transport
GO:0015671 oxygen transport
GO:0030097 hemopoiesis
GO:0030185 nitric oxide transport
GO:0048821 erythrocyte development
Cellular Component
GO:0005833 hemoglobin complex
GO:0043209 myelin sheath

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1jeb, PDBe:1jeb, PDBj:1jeb
PDBsum1jeb
PubMed11747442
UniProtP02088|HBB1_MOUSE Hemoglobin subunit beta-1 (Gene Name=Hbb-b1)

[Back to BioLiP]