Structure of PDB 1jdv Chain D

Receptor sequence

>1jdvD (length=227) Species: 2287 (Saccharolobus solfataricus)

NPVHILAKKGEVAERVLVVGDPGRARLLSTLLQNPKLTNENRGFLVYTGK
YNGETVSIATHGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGE
YIIVTGASYNQGGLFYQYLRDNACVASTPDFELTNKLVTSFSKRNLKYYV
GNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVL
VVSDNLAKELEKSVMDGAKAVLDTLTS

3D structure

• PDB: 1jdv Three-dimensional structure of a hyperthermophilic 5'-deoxy-5'-methylthioadenosine phosphorylase from Sulfolobus solfataricus.
• Chain: D
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H5 G21 R25 R43 E75 R86 T89 S204 D205 L207 L219
• Catalytic site (residue number reindexed from 1): H4 G20 R24 R42 E74 R85 T88 S203 D204 L206 L210
• Enzyme Commision number: 2.4.2.1: purine-nucleoside phosphorylase.
  2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SO4	D	G21 R25 R86 G88 T89	G20 R24 R85 G87 T88
BS02	ADN	D	T89 T90 F160 E163 V179 E180 M181 E182 D205	T88 T89 F159 E162 V178 E179 M180 E181 D204

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0016757 glycosyltransferase activity
• GO:0016763 pentosyltransferase activity
• GO:0017061 S-methyl-5-thioadenosine phosphorylase activity

Biological Process

• GO:0009116 nucleoside metabolic process
• GO:0009164 nucleoside catabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:1jdv, PDBe:1jdv, PDBj:1jdv
• PDBsum: 1jdv
• PubMed: 11489901
• UniProt: P50389|PNPH_SACS2 Purine nucleoside phosphorylase (Gene Name=SSO2706)